PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015888702.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Dof
Protein Properties Length: 327aa    MW: 34924.2 Da    PI: 8.7505
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015888702.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.22.1e-392482260
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                    +e++l+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknkk
  XP_015888702.1 24 PEEQLNCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGTLRNVPVGGGSRKNKK 82
                    6899*****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-261982IPR003851Zinc finger, Dof-type
PfamPF027011.2E-332682IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0962882IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103066IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MEEINHGSNA CTNKPAVLEK RARPEEQLNC PRCNSTNTKF CYYNNYSLTQ PRYFCKTCRR  60
YWTEGGTLRN VPVGGGSRKN KKPITPFSSS SSSSSSAAAA SSKSIPDLNP LSLSRQQFPC  120
LNPRPPPPHY QGQDLNLSFH KYYGGAASAN QYMEVQKSEN DTTTTSSSND NNNNNNLQSN  180
TAASASVPFS SSCSSIELVR SSSGIGSRAG GLNSFIQTTP MMMLDSNAMY PSGFYLQEVK  240
PTTTTTPFGF CVDGLGLGSR YGGVQENNSN NNGGGGSGSG SGSGRILFPF ADFKQVSTNA  300
ASDVDHQNKG QGNSSGYWNG LLGGGSW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015888702.10.0PREDICTED: dof zinc finger protein DOF2.5
RefseqXP_015888703.10.0PREDICTED: dof zinc finger protein DOF2.5
STRINGPOPTR_0014s09640.16e-75(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46590.12e-39Dof family protein